Gene Mb0341
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | alpha-d-glucose-1-phosphate thymidylyltransferase rmla (dtdp-glucose synthase) (dtdp-glucose pyrophosphorylase) |
| Comments | Mb0341, rmlA, len: 288 aa. Equivalent to Rv0334,len: 288 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 288 aa overlap). Probable rmlA (alternate gene name: rfbA), glucose-1-phosphate thymidylyl-transferase (EC 2.7.7.24), equivalent to CAC32020.1|AL583925 glucose-1-phosphate thymidyltransferase from Mycobacterium leprae (288 aa). Also highly similar to others e.g. AAG29804.1|AF235050 glucose-1-phosphate thymidylyltransferase from Streptomyces rishiriensis (296 aa); RBA1_ECOLI|P37744 glucose-1-phosphate thymidylyltransferase from Escherichia coli strain K12 (293 aa), FASTA scores: opt: 1199, E(): 0,(62.0% identity in 284 aa overlap). BELONGS TO THE GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE FAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 399688 | 400554 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0341|rmlA
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
Bibliography
No article yet recorded
