Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctiondTDP-L-rhamnose biosynthesis within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis [catalytic activity: dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose].
ProductAlpha-D-glucose-1-phosphate thymidylyltransferase RmlA (dTDP-glucose synthase) (dTDP-glucose pyrophosphorylase)
CommentsRv0334, (MTCY279.01), len: 288 aa. RmlA (alternate gene name: rfbA), alpha-D-glucose-1-phosphate thymidylyl-transferase (see citations below), equivalent to CAC32020.1|AL583925 glucose-1-phosphate thymidyltransferase from Mycobacterium leprae (288 aa). Also highly similar to others e.g. AAG29804.1|AF235050 glucose-1-phosphate thymidylyltransferase from Streptomyces rishiriensis (296 aa); RBA1_ECOLI|P37744 glucose-1-phosphate thymidylyltransferase from Escherichia coli strain K12 (293 aa), FASTA scores: opt: 1199, E(): 0, (62.0% identity in 284 aa overlap). Belongs to the glucose-1-phosphate thymidylyltransferase family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. smegmatis knockout shows rmlA is essential for growth and has an effect on cell morphology (See Qu et al., 2007). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS398658399524+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0334|rmlA
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
      
Bibliography