Gene Rv0334 (rfbA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | dTDP-L-rhamnose biosynthesis within the O antigen biosynthesis pathway of lipopolysaccharide biosynthesis [catalytic activity: dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose]. |
| Product | Alpha-D-glucose-1-phosphate thymidylyltransferase RmlA (dTDP-glucose synthase) (dTDP-glucose pyrophosphorylase) |
| Comments | Rv0334, (MTCY279.01), len: 288 aa. RmlA (alternate gene name: rfbA), alpha-D-glucose-1-phosphate thymidylyl-transferase (see citations below), equivalent to CAC32020.1|AL583925 glucose-1-phosphate thymidyltransferase from Mycobacterium leprae (288 aa). Also highly similar to others e.g. AAG29804.1|AF235050 glucose-1-phosphate thymidylyltransferase from Streptomyces rishiriensis (296 aa); RBA1_ECOLI|P37744 glucose-1-phosphate thymidylyltransferase from Escherichia coli strain K12 (293 aa), FASTA scores: opt: 1199, E(): 0, (62.0% identity in 284 aa overlap). Belongs to the glucose-1-phosphate thymidylyltransferase family. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). M. smegmatis knockout shows rmlA is essential for growth and has an effect on cell morphology (See Qu et al., 2007). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 398658 | 399524 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0334|rmlA
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN
Bibliography
- Ma Y, Mills JA, Belisle JT, Vissa V, Howell M, Bowlin K, Scherman MS and McNeil M [1997]. Determination of the pathway for rhamnose biosynthesis in mycobacteria: cloning, sequencing and expression of the Mycobacterium tuberculosis gene encoding alpha-D-glucose-1-phosphate thymidylyltransferase. Sequence Product Biochemistry
- Belanger AE and Inamine JM [2000]. Review
- Ma Y, Stern RJ, Scherman MS, Vissa VD, Yan W, Jones VC, Zhang F, Franzblau SG, Lewis WH and McNeil MR [2001]. Drug targeting Mycobacterium tuberculosis cell wall synthesis: genetics of dTDP-rhamnose synthetic enzymes and development of a microtiter plate-based screen for inhibitors of conversion of dTDP-glucose to dTDP-rhamnose. Product Biochemistry Function
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Qu H et al. [2007]. An rmlA gene encoding d-glucose-1-phosphate thymidylyltransferase is essential for mycobacterial growth. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
