Gene Mb0342c 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | pe family protein pe6 | 
| Comments | Mb0342c, PE6, len: 171 aa. Equivalent to Rv0335c,len: 171 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 171 aa overlap). Member of the Mycobacterium tuberculosis PE family (see first citation below); contains short region of similarity to part of the unique N-terminus of the Mycobacterium tuberculosis PGRS family of Glycine-rich proteins e.g. Y03A_MYCTU|Q10637 hypothetical glycine-rich 49.6 kd protein (603 aa), FASTA scores: opt: 219, E(): 1.1e-08, (51.5% identity in 66 aa overlap). | 
| Functional category | |
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 400565 | 401080 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0342c|PE6
MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATTRPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAAFHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRATRGFHNHRQ
      
    Bibliography
    No article yet recorded