Gene Mb0342c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | pe family protein pe6 |
Comments | Mb0342c, PE6, len: 171 aa. Equivalent to Rv0335c,len: 171 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 171 aa overlap). Member of the Mycobacterium tuberculosis PE family (see first citation below); contains short region of similarity to part of the unique N-terminus of the Mycobacterium tuberculosis PGRS family of Glycine-rich proteins e.g. Y03A_MYCTU|Q10637 hypothetical glycine-rich 49.6 kd protein (603 aa), FASTA scores: opt: 219, E(): 1.1e-08, (51.5% identity in 66 aa overlap). |
Functional category | |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 400565 | 401080 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0342c|PE6 MRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATTRPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAAFHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRATRGFHNHRQ
Bibliography
No article yet recorded