Gene Rv0335c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | PE family protein PE6 |
| Comments | Rv0335c, (MTCY279.02c), len: 171 aa. PE6, Member of the Mycobacterium tuberculosis PE family (see Brennan & Delogu 2002); contains short region of similarity to part of the unique N-terminus of the Mycobacterium tuberculosis PGRS family of Glycine-rich proteins e.g. Y03A_MYCTU|Q10637 hypothetical glycine-rich 49.6 kd protein (603 aa), FASTA scores: opt: 219, E(): 1.1e-08, (51.5% identity in 66 aa overlap). |
| Functional category | Pe/ppe |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 96h of starvation (see Betts et al., 2002). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 399535 | 400050 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0335c|PE6
VRSMGFLHRACRAPSSLPAPLMARPGRSVLARPAATPPGPLCATTRPRPPQGNQPPASRISNFPPKRHKTRVLAAAEDEVSAAVAALISAHGRRHHSLNNQAAAFHGQFAQNLNVGAGSCASAETTADAPTQALLGPADRQRRQRRAVRQWLVRWAAHPGRATRGFHNHRQ
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Brennan MJ et al. [2002]. The PE multigene family: a 'molecular mantra' for mycobacteria. Review
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant