Gene Mb0377c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | POSSIBLE OXIDOREDUCTASE |
| Comments | Mb0377c, -, len: 298 aa. Equivalent to Rv0370c,len: 298 aa, from Mycobacterium tuberculosis strain H37Rv,(99.7% identity in 298 aa overlap). Possible oxidoreductase (EC 1.-.-.-), similar to many hypothetical proteins, but also similar to ORF4|X82447|OCCOXMSL4_4 Protein of coxMSL gene cluster from Pseudomonas/Oligotropha carboxidovorans (295 aa), FASTA scores: opt: 851, E(): 0, (48.2% identity in 282 aa overlap); AJ224684|BJAJ4684_3 cooxS from Bradyrhizobium japonicum (302 aa), FASTA scores: opt: 881, E(): 0, (47.6% identity in 290 aa overlap). Also highly similar to MTCY428_21 from Mycobacterium tuberculosis. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 448164 | 449060 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0377c|Mb0377c
MTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPEPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA
Bibliography
No article yet recorded