Gene Rv0370c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv0370c, (MTV036.05c), len: 298 aa. Possible oxidoreductase, similar to many hypothetical proteins, but also similar to ORF4|X82447|OCCOXMSL4_4 Protein of coxMSL gene cluster from Pseudomonas/Oligotropha carboxidovorans (295 aa), FASTA scores: opt: 851, E(): 0, (48.2% identity in 282 aa overlap); AJ224684|BJAJ4684_3 cooxS from Bradyrhizobium japonicum (302 aa), FASTA scores: opt: 881, E(): 0, (47.6% identity in 290 aa overlap). Also highly similar to MTCY428_21 from Mycobacterium tuberculosis. Contains PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 447147 | 448043 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0370c|Rv0370c
VTFASPDDVIRRFDEQNYLLDTGTASAIYLAVTLGRPLLLEGEPGVGKTTAAKTLAVVLDTTLIRLQCYEGLTANEALYDWNYQRQLLSIRLAEARGKGISDISEADLYTEAYLVDRPILRCVRHRGPTPPVLLIDEIDRADDEFEALLLEFLGESAVTVPELGTFLAECPPIAVLTSNRSRDLHDALRRRCLYHWIDYPGPDRAAAIVRRTVPGATAPLIENATQFVCTARDLDLDKPPGVAETIDWVAALVALGVADLTAADSSPALASLGALAKTPDDRTQIRDAYQAFTECSHA
Bibliography
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
