Gene Mb0440
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | periplasmic superoxide dismutase [cu-zn] sodc |
| Comments | Mb0440, sodC, len: 240 aa. Equivalent to Rv0432,len: 240 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 240 aa overlap). Probable sodC,periplasmic superoxide dismutase [Cu-Zn] (EC 1.15.1.1),equivalent to CAC30880.1|AL583923 superoxide dismutase precursor (Cu-Zn) from Mycobacterium leprae (240 aa); and AAK20038.1|AF326234_1 copper zinc superoxide dismutase from Mycobacterium avium subsp. paratuberculosis (226 aa). Also similar to others e.g. SODC_PHOLE|P00446 superoxide dismutase precursor (cu-zn) from Photobacterium leiognathi (173 aa), FASTA scores: opt: 214, E(): 5.2 e-06, (36.5% identity in 181 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. BELONGS TO THE CU-ZN SUPEROXIDE DISMUTASE FAMILY. Possibly localized in periplasm, membrane-bound. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 520619 | 521341 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0440|sodC
MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG
Bibliography
No article yet recorded
