Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionDestroys radicals which are normally produced within the cells and are toxic to biological systems [catalytic activity: 2 superoxide + 2 H+ = O2 + H2O2].
ProductPeriplasmic superoxide dismutase [Cu-Zn] SodC
CommentsRv0432, (MTCY22G10.29), len: 240 aa. sodC, periplasmic superoxide dismutase [Cu-Zn], equivalent to CAC30880.1|AL583923 superoxide dismutase precursor (Cu-Zn) from Mycobacterium leprae (240 aa); and AAK20038.1|AF326234_1 copper zinc superoxide dismutase from Mycobacterium avium subsp. paratuberculosis (226 aa). Also similar to others e.g. SODC_PHOLE|P00446 superoxide dismutase precursor (Cu-Zn) from Photobacterium leiognathi (173 aa), FASTA scores: opt: 214, E(): 5.2 e-06, (36.5% identity in 181 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Belongs to the Cu-Zn superoxide dismutase family. Possibly localized in periplasm, membrane-bound.
Functional category-
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS519600520322+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0432|sodC
MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIWTGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTIATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGHTGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADNFANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG
      
Bibliography