Gene Mb0453c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | alternative rna polymerase sigma factor sigk |
| Comments | Mb0453c, sigK, len: 187 aa. Equivalent to Rv0445c,len: 187 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 187 aa overlap). Probable sigK,alternative RNA polymerase sigma factor (see citation below), highly similar to others e.g. 5531433|CAB50938.1|AL096849|T36745 probable RNA polymerase sigma factor from Streptomyces coelicolor (185 aa); NP_105607.1|14024791|BAB51393.1|AP003005 RNA polymerase sigma factor from Mesorhizobium loti (179 aa); 1654108|AAB17906.1|U11283|A58883 probable transcription initiation factor sigma E from Rhodobacter phaeroides (168 aa), FASTA scores: opt: 299, E(): 2e-14, (32.7% identity in 168 aa overlap); Q45585|SIGW_BACSU RNA POLYMERASE SIGMA FACTOR SIGW from Bacillus subtilis (187 aa), FASTA scores: opt: 213, E(): 2.9e-08, (26.8% identity in 179 aa overlap); etc. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 534852 | 535415 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0453c|sigK
MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS
Bibliography
No article yet recorded
