Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in transcription mechanism. The sigma factor is an initiation factor that promotes attachment of the RNA polymerase to specific initiation sites and then is released.
ProductAlternative RNA polymerase sigma factor SigK
CommentsRv0445c, (MTV037.09c), len: 187 aa. sigK, alternative RNA polymerase sigma factor (see citations below), highly similar to others e.g. 5531433|CAB50938.1|AL096849|T36745 probable RNA polymerase sigma factor from Streptomyces coelicolor (185 aa); NP_105607.1|14024791|BAB51393.1|AP003005 RNA polymerase sigma factor from Mesorhizobium loti (179 aa); 1654108|AAB17906.1|U11283|A58883 probable transcription initiation factor sigma E from Rhodobacter phaeroides (168 aa), FASTA scores: opt: 299, E(): 2e-14, (32.7% identity in 168 aa overlap); Q45585|SIGW_BACSU RNA polymerase sigma factor SIGW from Bacillus subtilis (187 aa), FASTA scores: opt: 213, E(): 2.9e-08, (26.8% identity in 179 aa overlap); etc.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS533833534396-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0445c|sigK
MTGPPRLSSDLDALLRRVAGHDQAAFAEFYDHTKSRVYGLVMRVLRDTGYSEETTQEIYLEVWRNASEFDSAKGSALAWLLTMAHRRAVDRVRCEQAGNQREVRYGAANVDPASDVVADLAIAGDERRRVTECLKALTDTQRQCIELAYYGGLTYVEVSRRLAANLSTIKSRMRDALRSLRNCLDVS
      
Bibliography