Gene Mb0466A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin MazE1 |
| Comments | Mb0466A, len: 41 aa. Equivalent to Rv0456B len: 57 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 40 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Possible mazE1,antitoxin, part of toxin-antitoxin (TA) operon with Rv0456A (See Pandey and Gerdes, 2005; Zhu et al., 2006). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 548363 | 548488 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0466A|mazE1
MRHEAKRELVYRGRRSIGRMPREWACRRSRRFAANGVDAAR
Bibliography
No article yet recorded