Gene Rv0456B
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin MazE1 |
Comments | Rv0456B, len: 57 aa. Possible mazE1, antitoxin, part of toxin-antitoxin (TA) operon with Rv0456A (See Pandey and Gerdes, 2005; Zhu et al., 2006). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 547344 | 547517 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0456B|mazE1 ITTYYYVLLSVTTWVGLRHEAKRELVYRGRRSIGRMPREWACRRSRRFAANGVDAAR
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Zhu L et al. [2006]. Characterization of mRNA interferases from Mycobacterium tuberculosis. Product
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant