Gene Mb0490c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible amidohydrolase |
| Comments | Mb0490c, -, len: 311 aa. Equivalent to Rv0480c,len: 340 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 311 aa overlap). Conserved hypothetical protein, equivalent, but longer 60 aa in N-terminus, to CAC31966.1|AL583925 putative hydrolase from Mycobacterium leprae (271 aa). Also similar to several hypothetical proteins and hydrolases e.g. AL096822|SCGD3_8 probable hydrolase from Streptomyces coelicolor (264 aa),FASTA scores: opt: 368, E(): 6.1e-15, (34.2% identity in 272 aa overlap); and YAUB_SCHPO|Q10166 hypothetical 35.7 kd protein c26a3.11 from S. pombe (322 aa), FASTA scores: opt: 338, E():1.4e-13, (30.3% identity in 277 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 56 bp deletion results in a different NH2 part and leads to a shorter product compared to its homolog in Mycobacterium tuberculosis strain H37Rv (329 aa versus 340 aa). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 569983 | 570918 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0490c|Mb0490c
MRRARRRAQAGLPGSCARRCGALVAGPRLARMRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG
Bibliography
No article yet recorded
