Gene Rv0480c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; hydrolytic enzyme probably involved in cellular metabolism. |
| Product | Possible amidohydrolase |
| Comments | Rv0480c, (MTCY20G9.06c), len: 280 aa. Possible amidohydrolase, highly similar to NP_302587.1|NC_002677|CAC31966.1|AL583925 putative hydrolase from Mycobacterium leprae (271 aa). Also similar to other hydrolases and hypothetical proteins e.g. NP_601985.1|NC_003450 Predicted amidohydrolase from Corynebacterium glutamicum (266 aa); NP_459623.1|NC_003197 putative hydrolase from Salmonella typhimurium LT2 (262 aa); AL096822|SCGD3_8|NP_627996.1|NC_003888 probable hydrolase from Streptomyces coelicolor (264 aa), FASTA scores: opt: 368, E(): 6.1e-15, (34.2% identity in 272 aa overlap); YAUB_SCHPO|Q10166 hypothetical 35.7 kDa protein c26a3.11 from S. pombe (322 aa), FASTA scores: opt: 338, E():1.4e-13, (30.3% identity in 277 aa overlap); etc. Start changed since first submission (-60 aa). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 568964 | 569806 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0480c|Rv0480c
MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPLRQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGTPNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIRFPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAAGQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADIDVDNVAAARDRIAVLRNQTDFVQIDKAQSRG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant