Gene Mb0529c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible anti-anti-sigma factor |
| Comments | Mb0529c, -, len: 158 aa. Equivalent to Rv0516c,len: 158 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 158 aa overlap). Conserved hypothetical protein, showing some similarity to Rv1365c|MTCY02B10_29 from Mycobacterium tuberculosis (128 aa), FASTA scores: E(): 0.0012, (27.4% identity in 124 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 609210 | 609686 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0529c|Mb0529c
MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA
Bibliography
No article yet recorded