Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionMay be involved in regulating sigma factor
ProductPossible anti-anti-sigma factor
CommentsRv0516c, (MTCY20G10.06c), len: 158 aa. Possible anti-anti-sigma factor, showing some similarity to Rv1365c|MTCY02B10_29 from Mycobacterium tuberculosis (128 aa), FASTA scores: E(): 0.0012, (27.4% identity in 124 aa overlap).
Functional categoryInformation pathways
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: possibly down-regulated by hspR|Rv0353 (see Stewart et al., 2002) and up-regulated after 4h, 24h, and 96h of starvation (see Betts et al., 2002). DNA microarrays show higher level of expression in M. tuberculosis H37Rv during Mg2+ starvation (See Walters et al., 2006).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS608059608535-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0516c|Rv0516c
MTTTIPTSKSACSVTTRPGNAAVDYGGAQIRAYLHHLATVVTIRGEIDAANVEQISEHVRRFSLGTNPMVLDLSELSHFSGAGISLLCILDEDCRAAGVQWALVASPAVVEQLGGRCDQGEHESMFPMARSVHKALHDLADAIDRRRQLVLPLISRSA