Gene Mb0573
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | PROBABLE UBIQUINONE/MENAQUINONE BIOSYNTHESIS METHYLTRANSFERASE MENH (2-heptaprenyl-1,4-naphthoquinone methyltransferase) |
| Comments | Mb0573, menH, len: 234 aa. Equivalent to Rv0558,len: 234 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 234 aa overlap). Probable menH (alternate gene name: menG), ubiquinone/menaquinone biosynthesis methlytransferase (2-heptaprenyl-1,4-naphthoquinone methyltransferase) (EC 2.1.1.-), equivalent to NP_302480.1|NC_002677 putative ubiquinone/menaquinone biosynthesis methyltransferase from Mycobacterium leprae (238 aa). Also highly similar to others e.g. CAB44537.1|AL078618|T34630 from Streptomyces coelicolor (231 aa); UBIE_ECOLI|P27851 from Escherichia coli strain K12 (251 aa), FASTA scores: opt: 421, E(): 1.2e-21, (43.2% identity in 227 aa overlap); GRC2_BACSU|P31113 from Bacillus subtilis (233 aa), FASTA scores: opt: 345, E(): 1.4e-16, (34.6% identity in 231 aa overlap); etc. BELONGS TO THE UBIE FAMILY. Note that previously known as ubiE. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 650932 | 651636 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0573|menH
MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEYLMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVALHAGYKPGKQTPQ
Bibliography
No article yet recorded
