Gene Rv0558 (menG, ubiE)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in menaquinone biosynthesis (at the last step) converts DMKH2 into MKH2 [catalytic activity: S-adenosyl-L-methionine + demethylmenaquinol = S-adenosyl-L-homocysteine + menaquinol]. |
| Product | Probable ubiquinone/menaquinone biosynthesis methyltransferase MenH (2-heptaprenyl-1,4-naphthoquinone methyltransferase) |
| Comments | Rv0558, (MTCY25D10.37), len: 234 aa. Probable menH (alternate gene name: menG), ubiquinone/menaquinone biosynthesis methlytransferase (2-heptaprenyl-1,4-naphthoquinone methyltransferase), equivalent to NP_302480.1|NC_002677 putative ubiquinone/menaquinone biosynthesis methyltransferase from Mycobacterium leprae (238 aa). Also highly similar to others e.g. CAB44537.1|AL078618|T34630 from Streptomyces coelicolor (231 aa); UBIE_ECOLI|P27851 from Escherichia coli strain K12 (251 aa), FASTA scores: opt: 421, E(): 1.2e-21, (43.2% identity in 227 aa overlap); GRC2_BACSU|P31113 from Bacillus subtilis (233 aa), FASTA scores: opt: 345, E(): 1.4e-16, (34.6% identity in 231 aa overlap); etc. Belongs to the UbiE family. Note that previously known as ubiE. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 649689 | 650393 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0558|menH
MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEYLMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVALHAGYKPGKQTPQ
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
