Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in menaquinone biosynthesis (at the last step) converts DMKH2 into MKH2 [catalytic activity: S-adenosyl-L-methionine + demethylmenaquinol = S-adenosyl-L-homocysteine + menaquinol].
ProductProbable ubiquinone/menaquinone biosynthesis methyltransferase MenH (2-heptaprenyl-1,4-naphthoquinone methyltransferase)
CommentsRv0558, (MTCY25D10.37), len: 234 aa. Probable menH (alternate gene name: menG), ubiquinone/menaquinone biosynthesis methlytransferase (2-heptaprenyl-1,4-naphthoquinone methyltransferase), equivalent to NP_302480.1|NC_002677 putative ubiquinone/menaquinone biosynthesis methyltransferase from Mycobacterium leprae (238 aa). Also highly similar to others e.g. CAB44537.1|AL078618|T34630 from Streptomyces coelicolor (231 aa); UBIE_ECOLI|P27851 from Escherichia coli strain K12 (251 aa), FASTA scores: opt: 421, E(): 1.2e-21, (43.2% identity in 227 aa overlap); GRC2_BACSU|P31113 from Bacillus subtilis (233 aa), FASTA scores: opt: 345, E(): 1.4e-16, (34.6% identity in 231 aa overlap); etc. Belongs to the UbiE family. Note that previously known as ubiE.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS649689650393+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0558|menH
MSRAALDKDPRDVASMFDGVARKYDLTNTVLSLGQDRYWRRATRSALRIGPGQKVLDLAAGTAVSTVELTKSGAWCVAADFSVGMLAAGAARKVPKVAGDATRLPFGDDVFDAVTISFGLRNVANQQAALREMARVTRPGGRLLVCEFSTPTNALFATAYKEYLMRALPRVARAVSSNPEAYEYLAESIRAWPDQAVLAHQISRAGWSGVRWRNLTGGIVALHAGYKPGKQTPQ