Gene Mb0617c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | two component sensor kinase [first part] |
Comments | Mb0617c, -, len: 156 aa. Equivalent to Rv0601c,len: 156 aa (probable partial CDS), from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 156 aa overlap). Probable two-component sensor kinase (first part) (EC 2.7.3.-), similar to part (N-termini) of others e.g. Q0375|CUTS_STRLI cuts protein from streptomyces lividans (414 aa), FASTA scores: opt: 230, E(): 3.1e-08,(39.1% identity in 115 aa overlap). Note that the sequence was checked and no errors were detected that would allow this and the downstream ORF to be joined. |
Functional category | Regulatory proteins |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 699769 | 700239 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0617c|Mb0617c MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS
Bibliography
No article yet recorded