Gene Rv0601c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Sensor part of a two component regulatory system. |
| Product | Two component sensor kinase [first part] |
| Comments | Rv0601c, (MTCY19H5.21), len: 156 aa (probable partial CDS). Two-component sensor kinase (first part), similar to part (N-termini) of others e.g. Q0375|CUTS_STRLI cuts protein from streptomyces lividans (414 aa), FASTA scores: opt: 230, E(): 3.1e-08, (39.1% identity in 115 aa overlap). Note that the sequence was checked and no errors were detected that would allow this and the downstream ORF to be joined. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 698524 | 698994 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0601c|Rv0601c
MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS
Bibliography
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant