Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionSensor part of a two component regulatory system.
ProductTwo component sensor kinase [first part]
CommentsRv0601c, (MTCY19H5.21), len: 156 aa (probable partial CDS). Two-component sensor kinase (first part), similar to part (N-termini) of others e.g. Q0375|CUTS_STRLI cuts protein from streptomyces lividans (414 aa), FASTA scores: opt: 230, E(): 3.1e-08, (39.1% identity in 115 aa overlap). Note that the sequence was checked and no errors were detected that would allow this and the downstream ORF to be joined. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS698524698994-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0601c|Rv0601c
MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS