Gene Mb0624
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb28 |
| Comments | Mb0624, -, len: 81 aa. Equivalent to Rv0608, len: 81 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Conserved hypothetical protein, similar to several other Mycobacterium tuberculosis hypothetical short proteins e.g. Rv0623|P96913|MTCY20H10.04 (84 aa), FASTA scores: opt: 159, E(): 1.2e-09, (43.0% identity in 86 aa overlap); Rv2760c (89 aa); Rv1740 (70 aa), etc. |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 704489 | 704734 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0624|vapb28
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA
Bibliography
No article yet recorded