Gene Mb0624 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | possible antitoxin vapb28 | 
| Comments | Mb0624, -, len: 81 aa. Equivalent to Rv0608, len: 81 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Conserved hypothetical protein, similar to several other Mycobacterium tuberculosis hypothetical short proteins e.g. Rv0623|P96913|MTCY20H10.04 (84 aa), FASTA scores: opt: 159, E(): 1.2e-09, (43.0% identity in 86 aa overlap); Rv2760c (89 aa); Rv1740 (70 aa), etc. | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 704489 | 704734 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0624|vapb28
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA
      
    Bibliography
    No article yet recorded