Gene Rv0608
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Possible antitoxin VapB28 |
Comments | Rv0608, (MTCY19H5.14c), len: 81 aa. Possible vapB28, antitoxin, part of toxin-antitoxin (TA) operon with Rv0609, see Arcus et al. 2005. Similar to several others e.g. Rv0623|P96913|MTCY20H10.04 (84 aa), FASTA scores: opt: 159, E(): 1.2e-09, (43.0% identity in 86 aa overlap); Rv2760c (89 aa); Rv1740 (70 aa), etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
Functional category | Virulence, detoxification, adaptation |
Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 703244 | 703489 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0608|vapB28 MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLPA
Bibliography
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence