Gene Mb0653
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 50s ribosomal protein l33 rpmg2 |
| Comments | Mb0653, rpmG2, len: 55 aa. Equivalent to Rv0634B,len: 55 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 55 aa overlap). Probable rpmG2, 50S ribosomal protein L33. Note that Mycobacterium tuberculosis has a second rpmG gene: P96925|R33H_MYCTU|Rv2057c|MTCY63A.03|rpmG1 PUTATIVE 50S RIBOSOMAL PROTEIN L33 (55 aa), FASTA scores: opt: 391,E(): 2.9e-25, (100.0% identity in 55 aa overlap). BELONGS TO THE L33P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 732948 | 733115 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0653|rpmG2
MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR
Bibliography
No article yet recorded