Gene Rv0634B
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in translation mechanism |
| Product | 50S ribosomal protein L33 RpmG2 |
| Comments | Rv0634B, len: 55 aa. rpmG2, 50S ribosomal protein L33. Note that Mycobacterium tuberculosis has a second rpmG gene: P96925|R33H_MYCTU|Rv2057c|MTCY63A.03|rpmG1 putative 50S ribosomal protein L33 (55 aa), FASTA scores: opt: 391, E(): 2.9e-25, (100.0% identity in 55 aa overlap). Belongs to the L33P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 731712 | 731879 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0634B|rpmG2
MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR
Bibliography
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
