Gene Mb0656
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | (3r)-hydroxyacyl-acp dehydratase subunit hadc |
| Comments | Mb0656, -, len: 166 aa. Equivalent to Rv0637, len: 166 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 166 aa overlap). Conserved hypothetical protein, equivalent to NP_302285.1|NC_002677|YV31_MYCLE|P54879 conserved hypothetical protein from Mycobacterium leprae (166 aa),FASTA scores: opt: 352, E(): 4e-19, (39.2% identity in 148 aa overlap); and highly similar to others from Mycobacterium leprae e.g. NP_302287.1|NC_002677 conserved hypothetical protein (159 aa). Also highly similar to CAB77410.1|AL160431|SCD82.07 hypothetical protein from Streptomyces coelicolor (150 aa); Rv0635|NP_215149.1|NC_000962|MTY20H10_17 conserved hypothetical protein (two ORFs upstream) from Mycobacterium tuberculosis (158 aa), FASTA score: (49.3% identity in 150 aa overlap); and Rv0504c|NP_215018.1|NC_000962|YV31_MYCTU|Q11168 hypothetical protein from Mycobacterium tuberculosis (166 aa), FASTA scores: opt: 380, E(): 3.8e-21, (43.1% identity in 137 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 734061 | 734561 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0656|hadc
MALKTDIRGMIWRYPDYFIVGREQCREFARAVKCDHPAFFSEEAAADLGYDALVAPLTFVTILAKYVQLDFFRHVDVGMETMQIVQVDQRFVFHKPVLAGDKLWARMDIHSVDERFGADIVVTRNLCTNDDGELVMEAYTTLMGQQGDGSARLKWDKESGQVIRTA
Bibliography
No article yet recorded