Gene Mb0676c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible antitoxin vapb6 |
Comments | Mb0676c, -, len: 51 aa. Equivalent to Rv0657c, len: 51 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 51 aa overlap). Conserved hypothetical protein, showing similarity with hypothetical proteins from Mycobacterium tuberculosis e.g. Rv2009|MT2064.1|MTCY39.08c|YW08_MYCTU|Q10848 (80 aa),FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958|SC4H8_7 from Streptomyces coelicolor (66 aa), FASTA score: (41.0% identity in 39 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 755231 | 755386 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0676c|vapb6 MSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE
Bibliography
No article yet recorded