Gene Rv0657c 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Possible antitoxin VapB6 | 
| Comments | Rv0657c, (MTCI376.19), len: 51 aa. Possible vapB6, antitoxin, part of toxin-antitoxin (TA) operon with Rv0656c (See Arcus et al., 2005; Pandey and Gerdes, 2005). Similarity with others from Mycobacterium tuberculosis e.g. Rv2009|MT2064.1|MTCY39.08c|YW08_MYCTU|Q10848 (80 aa), FASTA scores: opt: 107, E(): 0.0038, (45.8% identity in 48 aa overlap), Rv2871, Rv1560, etc. Also some similarity with AL020958|SC4H8_7 from Streptomyces coelicolor (66 aa), FASTA score: (41.0% identity in 39 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). | 
| Functional category | Virulence, detoxification, adaptation | 
| Mutant | Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 753462 | 753617 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv0657c|vapB6
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant