Gene Mb0701
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 30s ribosomal protein s12 rpsl |
Comments | Mb0701, rpsL, len: 124 aa. Equivalent to Rv0682,len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 124 aa overlap). Probable rpsL, 30S ribosomal protein S12 (see citations below), equivalent to others from Mycobacteria e.g. P41195|RS12_MYCSM 30S RIBOSOMAL PROTEIN S12 from Mycobacterium smegmatis (124 aa); P51999|RS12_MYCAV 30S RIBOSOMAL PROTEIN S12 from Mycobacterium avium (124 aa); etc. Also highly similar to others from other organisms e.g. P97222|RS12_STRCO 30S RIBOSOMAL PROTEIN S12 from Streptomyces roseosporus,lividans and coelicolor (123 aa); etc. Contains PS00055 Ribosomal protein S12 signature. BELONGS TO THE S12P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 783329 | 783703 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0701|rpsL MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG
Bibliography
No article yet recorded