Gene Mb0701 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | 30s ribosomal protein s12 rpsl | 
| Comments | Mb0701, rpsL, len: 124 aa. Equivalent to Rv0682,len: 124 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 124 aa overlap). Probable rpsL, 30S ribosomal protein S12 (see citations below), equivalent to others from Mycobacteria e.g. P41195|RS12_MYCSM 30S RIBOSOMAL PROTEIN S12 from Mycobacterium smegmatis (124 aa); P51999|RS12_MYCAV 30S RIBOSOMAL PROTEIN S12 from Mycobacterium avium (124 aa); etc. Also highly similar to others from other organisms e.g. P97222|RS12_STRCO 30S RIBOSOMAL PROTEIN S12 from Streptomyces roseosporus,lividans and coelicolor (123 aa); etc. Contains PS00055 Ribosomal protein S12 signature. BELONGS TO THE S12P FAMILY OF RIBOSOMAL PROTEINS. | 
| Functional category | Information pathways | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 783329 | 783703 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0701|rpsL
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG
      
    Bibliography
    No article yet recorded