Gene Rv0682
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Protein S12 is involved in the translation initiation step. |
| Product | 30S ribosomal protein S12 RpsL |
| Comments | Rv0682, (MTV040.10), len: 124 aa. rpsL, 30S ribosomal protein S12 (see citations below), equivalent to others from Mycobacteria e.g. P41195|RS12_MYCSM 30S ribosomal protein S12 from Mycobacterium smegmatis (124 aa); P51999|RS12_MYCAV 30S ribosomal protein S12 from Mycobacterium avium (124 aa); etc. Also highly similar to others from other organisms e.g. P97222|RS12_STRCO 30S ribosomal protein S12 from Streptomyces roseosporus, lividans and coelicolor (123 aa); etc. Contains PS00055 Ribosomal protein S12 signature. Belongs to the S12P family of ribosomal proteins. Nucleotide position 781922 in the genome sequence has been corrected, A:G resulting in K121K. |
| Functional category | Information pathways |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 781560 | 781934 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0682|rpsL
MPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEKG
Bibliography
- Kenney TJ et al. [1994]. Cloning and sequence analysis of the rpsL and rpsG genes of Mycobacterium smegmatis and characterization of mutations causing resistance to streptomycin. Homolog Sequence
- Kenney TJ and Churchward G [1996]. Genetic analysis of the Mycobacterium smegmatis rpsL promoter. Homolog Regulation
- Mulder MA et al. [1997]. Mycobacterial promoters. Review Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Niemann S, Koser CU, Gagneux S, Plinke C, Homolka S, Bignell H, Carter RJ, Cheetham RK, Cox A, Gormley NA, Kokko-Gonzales P, Murray LJ, Rigatti R, Smith VP, Arends FP, Cox HS, Smith G and Archer JA [2009]. Genomic diversity among drug sensitive and multidrug resistant isolates of Mycobacterium tuberculosis with identical DNA fingerprints. Sequence
- Ioerger TR et al. [2010]. Variation among genome sequences of H37Rv strains of Mycobacterium tuberculosis from multiple laboratories. Sequence
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
