Gene Mb0710A 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Mycofactocin precursor protein | 
| Comments | Mb0710A, len: 62 aa. Equivalent to Rv0691A len: 62 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 62 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Mycofactocin precursor protein. | 
| Functional category | Intermediary metabolism and respiration | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 793427 | 793615 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0710A|Mb0710A
MRHHIRPSISALDAILCPDRRIAVETCWRKAIQMDYETDTDTELVTETLVEEVSIDGMCGVY
      
    Bibliography
    No article yet recorded