Gene Mb0710A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Mycofactocin precursor protein |
| Comments | Mb0710A, len: 62 aa. Equivalent to Rv0691A len: 62 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 62 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Mycofactocin precursor protein. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 793427 | 793615 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0710A|Mb0710A
MRHHIRPSISALDAILCPDRRIAVETCWRKAIQMDYETDTDTELVTETLVEEVSIDGMCGVY
Bibliography
No article yet recorded