Gene Rv0691A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Electron carrier |
| Product | Mycofactocin precursor protein |
| Comments | Rv0691A, len: 62 aa. Mycofactocin precursor protein. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 791658 | 791846 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0691A|Rv0691A
VRHHIRPSISALDAILCPDRRIAVETCWRKAIQMDYETDTDTELVTETLVEEVSIDGMCGVY
Bibliography
- Haft DH [2011]. Bioinformatic evidence for a widely distributed, ribosomally produced electron carrier precursor, its maturation proteins, and its nicotinoprotein redox partners. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant