Gene Mb0721
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l3 rplc |
Comments | Mb0721, rplC, len: 217 aa. Equivalent to Rv0701,len: 217 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 217 aa overlap). Probable rplC, 50S ribosomal protein L3, equivalent to O06044|RL3_MYCBO 50S RIBOSOMAL PROTEIN L3 from Mycobacterium bovis BCG (217 aa); and P30762|RL3_MYCLE 50S RIBOSOMAL PROTEIN L3 from Mycobacterium leprae (217 aa). Also highly similar to others e.g. CAB82070.1|AL161803 50S ribosomal protein L3 from Streptomyces coelicolor (214 aa); P52860|RL3_THETH ribosomal protein l3 from Thermus aquaticus (206 aa),FASTA scores: opt: 717, E(): 0, (55.2% identity in 210 aa overlap); etc. Contains PS00474 Ribosomal protein L3 signature. BELONGS TO THE L3P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 802577 | 803230 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0721|rplC MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERDGYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAEIFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKGTRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK
Bibliography
No article yet recorded