Gene Rv0701
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | This protein binds directly to 23S ribosomal RNA and may participate in the formation of the peptidyltransferase center of the ribosome. |
| Product | 50S ribosomal protein L3 RplC |
| Comments | Rv0701, (MTCY210.20), len: 217 aa. rplC, 50S ribosomal protein L3, equivalent to O06044|RL3_MYCBO 50S ribosomal protein L3 from Mycobacterium bovis BCG (217 aa); and P30762|RL3_MYCLE 50S ribosomal protein L3 from Mycobacterium leprae (217 aa). Also highly similar to others e.g. CAB82070.1|AL161803 50S ribosomal protein L3 from Streptomyces coelicolor (214 aa); P52860|RL3_THETH ribosomal protein l3 from Thermus aquaticus (206 aa), FASTA scores: opt: 717, E(): 0, (55.2% identity in 210 aa overlap); etc. Contains PS00474 Ribosomal protein L3 signature. Belongs to the L3P family of ribosomal proteins. |
| Functional category | Information pathways |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, CEGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: possibly down-regulated by hspR|Rv0353, and down-regulated after 24h and 96h of starvation (see citations below). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 800809 | 801462 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0701|rplC
MARKGILGTKLGMTQVFDESNRVVPVTVVKAGPNVVTRIRTPERDGYSAVQLAYGEISPRKVNKPLTGQYTAAGVNPRRYLAELRLDDSDAATEYQVGQELTAEIFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPARVFKGTRMAGRMGNDRVTVLNLLVHKVDAENGVLLIKGAVPGRTGGLVMVRSAIKRGEK
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
