Gene Mb0730
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | 30s ribosomal protein s17 rpsq |
| Comments | Mb0730, rpsQ, len: 136 aa. Equivalent to Rv0710,len: 136 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 136 aa overlap). Probable rpsQ, 30S ribosomal protein S17, equivalent to O06051|RS17_MYCBO 30S|MBS10OPER_11 30S RIBOSOMAL PROTEIN S17 from Mycobacterium bovis BCG (136 aa); and MLCB2492_11 30S RIBOSOMAL PROTEIN S17 from Mycobacterium leprae (126 aa). Also highly similar to others e.g. CAB82079.1|AL161803 30S ribosomal protein S17 from Streptomyces coelicolor (95 aa); P12874|RS17_BACSU 30s ribosomal protein s17 (bs 16) from Bacillus subtilis (86 aa), FASTA scores: opt: 305,E(): 1.6e-11, (60.5% identity in 81 aa overlap); etc. Contains PS00056 Ribosomal protein S17 signature. BELONGS TO THE S17P FAMILY OF RIBOSOMAL PROTEINS. |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 807578 | 807988 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0730|rpsQ
MMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK
Bibliography
No article yet recorded