Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionProtein S17 binds specifically to the 5' end of 16S ribosomal RNA.
Product30S ribosomal protein S17 RpsQ
CommentsRv0710, (MTCY210.29), len: 136 aa. rpsQ, 30S ribosomal protein S17, equivalent to O06051|RS17_MYCBO 30S|MBS10OPER_11 30S ribosomal protein S17 from Mycobacterium bovis BCG (136 aa); and MLCB2492_11 30S ribosomal protein S17 from Mycobacterium leprae (126 aa). Also highly similar to others e.g. CAB82079.1|AL161803 30S ribosomal protein S17 from Streptomyces coelicolor (95 aa); P12874|RS17_BACSU 30s ribosomal protein s17 (bs 16) from Bacillus subtilis (86 aa), FASTA scores: opt: 305, E(): 1.6e-11, (60.5% identity in 81 aa overlap); etc. Contains PS00056 Ribosomal protein S17 signature.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS805756806166+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0710|rpsQ
VMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK