Gene Rv0710 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Protein S17 binds specifically to the 5' end of 16S ribosomal RNA. | 
| Product | 30S ribosomal protein S17 RpsQ | 
| Comments | Rv0710, (MTCY210.29), len: 136 aa. rpsQ, 30S ribosomal protein S17, equivalent to O06051|RS17_MYCBO 30S|MBS10OPER_11 30S ribosomal protein S17 from Mycobacterium bovis BCG (136 aa); and MLCB2492_11 30S ribosomal protein S17 from Mycobacterium leprae (126 aa). Also highly similar to others e.g. CAB82079.1|AL161803 30S ribosomal protein S17 from Streptomyces coelicolor (95 aa); P12874|RS17_BACSU 30s ribosomal protein s17 (bs 16) from Bacillus subtilis (86 aa), FASTA scores: opt: 305, E(): 1.6e-11, (60.5% identity in 81 aa overlap); etc. Contains PS00056 Ribosomal protein S17 signature. | 
| Functional category | Information pathways | 
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). | 
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 4h, 24h and 96h of starvation (see citation below). | 
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 805756 | 806166 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv0710|rpsQ
VMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPRTPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK
      
    Bibliography
    - Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant