Gene Mb0741
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | 50s ribosomal protein l18 rplr |
Comments | Mb0741, rplR, len: 122 aa. Equivalent to Rv0720,len: 122 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 122 aa overlap). Probable rplR, 50S ribosomal protein L18, equivalent to O32999|MLCB2492_20|RL18_MYCLE 50S RIBOSOMAL PROTEIN L18 from Mycobacterium leprae (122 aa). Also highly similar to others e.g. CAB82086.1|AL161803 50S ribosomal protein L18 from Streptomyces coelicolor (127 aa); P33102|RL18_MICLU 50s ribosomal protein L18 from Micrococcus luteus (119 aa), FASTA scores: opt: 447, E(): 8.7e-24, (60.4% identity in 111 aa overlap); etc. BELONGS TO THE L18P FAMILY OF RIBOSOMAL PROTEINS. |
Functional category | Information pathways |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 815762 | 816130 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0741|rplR MAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGGRIAALADAARENGLSF
Bibliography
No article yet recorded