Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThis is one of 3 proteins that mediate the attachment of the 5S RNA into the large ribosomal subunit.
Product50S ribosomal protein L18 RplR
CommentsRv0720, (MTCY210.39), len: 122 aa. rplR, 50S ribosomal protein L18, equivalent to O32999|MLCB2492_20|RL18_MYCLE 50S ribosomal protein L18 from Mycobacterium leprae (122 aa). Also highly similar to others e.g. CAB82086.1|AL161803 50S ribosomal protein L18 from Streptomyces coelicolor (127 aa); P33102|RL18_MICLU 50s ribosomal protein L18 from Micrococcus luteus (119 aa), FASTA scores: opt: 447, E(): 8.7e-24, (60.4% identity in 111 aa overlap); etc. Belongs to the L18P family of ribosomal proteins.
Functional categoryInformation pathways
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS813940814308+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0720|rplR
MAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGGRIAALADAARENGLSF