Gene Mb0757
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | anti-sigma factor rsla |
| Comments | Mb0757, -, len: 250 aa. Equivalent to Rv0736, len: 250 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 250 aa overlap). Probable conserved membrane protein, showing weak similarity with AL133469|SCM10_32 putative membrane protein from Streptomyces coelicolor (216 aa), FASTA scores: opt: 180,E(): 0.00018, (34.3% identity in 216 aa overlap). |
| Functional category | Information pathways |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 829962 | 830714 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0757|rsla
MTMPLRGLGPPDDTGVREVSTGDDHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESAPTVVASGLSPELLPSLLAAVHRRRRRTRLITWVASSAAAAVLAIGVLVGVQGHSAAPQRAAVSALPMAQVGTQLLASTVSISGEPWGTFINLRCVCLAPPYASHDTLAMVVVGRDGSQTRLATWLAEPGHTATPAGSISTPVDQIAAVQVVAADTGQVLLQRSL
Bibliography
No article yet recorded