Gene Rv0736
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Regulates negatively SIGL|Rv0735 |
| Product | Anti-sigma factor RslA |
| Comments | Rv0736, (MTV041.10), len: 250 aa. RslA, anti-sigma factor (See Dainese et al., 2006). Probable membrane protein, showing weak similarity with AL133469|SCM10_32 putative membrane protein from Streptomyces coelicolor (216 aa), FASTA scores: opt: 180, E(): 0.00018, (34.3% identity in 216 aa overlap). Cleaved by Rip|Rv2869c, in M. tuberculosis Erdman (See Sklar et al., 2010). |
| Functional category | Information pathways |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). DBA/2 mice infected with M. tuberculosis H37Rv mutated at sigL|Rv0735 and rslA|Rv0736 survive longer than those infected with wild-type (See Dainese et al., 2006). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 828140 | 828892 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0736|rslA
MTMPLRGLGPPDDTGVREVSTGDDHHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESAPTVVASGLSPELLPSLLAAVHRRRRRTRLITWVASSAAAAVLAIGVLVGVQGHSAAPQRAAVSALPMAQVGTQLLASTVSISGEPWGTFINLRCVCLAPPYASHDTLAMVVVGRDGSQTRLATWLAEPGHTATPAGSISTPVDQIAAVQVVAADTGQVLLQRSL
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Hahn MY, Raman S, Anaya M and Husson RN [2005]. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. Biochemistry
- Dainese E et al. [2006]. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Function Mutant Product
- Sklar JG et al. [2010]. M. tuberculosis intramembrane protease Rip1 controls transcription through three anti-sigma factor substrates. Biochemistry
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant