Gene Mb0769
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb31 |
| Comments | Mb0769, -, len: 85 aa. Equivalent to Rv0748, len: 85 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 85 aa overlap). Conserved hypothetical protein, N-terminus similar to N-terminal region of NP_436939.1|NC_003078 HYPOTHETICAL PROTEIN from Sinorhizobium meliloti (75 aa). Also similar to Mycobacterium tuberculosis proteins Rv2871 CONSERVED HYPOTHETICAL PROTEIN (75 aa); Rv1241, Rv2132, Rv3321c,etc. |
| Functional category | - |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 843137 | 843394 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0769|vapb31
MRTTVSISDEILAAAKRRARERGQSLGAVIEDALRREFAAAHVGGARPTVPVFDGGTGPRRGIDLTSNRALSEVLDEGLELNSRK
Bibliography
No article yet recorded