Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible antitoxin VapB31
CommentsRv0748, (MTV041.22), len: 85 aa. Possible vapB31, antitoxin, part of toxin-antitoxin (TA) operon with Rv0749, see Arcus et al. 2005. Also similar to others in Mycobacterium tuberculosis proteins e.g. Rv2871 (75 aa); Rv1241, Rv2132, Rv3321c, etc. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryVirulence, detoxification, adaptation
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS840947841204+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0748|vapB31
MRTTVSISDEILAAAKRRARERGQSLGAVIEDALRREFAAAHVGGARPTVPVFDGGTGPRRGIDLTSNRALSEVLDEGLELNSRK