Gene Mb0772
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb0772, -, len: 81 aa. Equivalent to Rv0750, len: 81 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 81 aa overlap). Conserved hypothetical protein, showing almost perfect overlap with C-terminus of Rv0740|MTV041_14 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (175 aa), FASTA scores: (93.8% identity in 81 aa overlap). Possible duplication. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 844223 | 844468 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0772|Mb0772
MRAIVGDCVIHIMPMGTGVELSKLADLALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG
Bibliography
No article yet recorded