Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0750, (MTV041.24), len: 81 aa. Conserved hypothetical protein, showing almost perfect overlap with C-terminus of Rv0740|MTV041_14 conserved hypothetical protein from Mycobacterium tuberculosis (175 aa), FASTA scores: (93.8% identity in 81 aa overlap). Possible duplication. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS842033842278+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0750|Rv0750
VRAIVGDCVIHIMPMGTGVELSKLADLALDIGRSVGCSAYENDFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG