Gene Mb0782c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb0782c, -, len: 110 aa. Equivalent to Rv0759c,len: 110 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 110 aa overlap). Conserved hypothetical protein, highly similar (but shorter 45 aa in N-terminus) to P49774|YHIT_MYCLE|ML2237|MLCB5.04c|U296A HYPOTHETICAL HIT-LIKE PROTEIN from Mycobacterium leprae (155 aa), FASTA scores: opt: 766, E(): 0, (78.7% identity in 150 aa overlap). Also highly similar (but N-terminus always shorter) to HIT-like proteins and protein kinase inhibitors e.g. AAF72728.1|AF265258_1|AF265258 HIT-like protein from Rhodococcus sp. (141 aa); NP_212513.1|NC_001318 protein kinase C1 inhibitor (pkcI) from Borrelia burgdorferi (149 aa) ; P94252|YHIT_BORBU|BB0379 HYPOTHETICAL HIT-LIKE PROTEIN from Borrelia burgdorferi (139 aa); NP_110768.1|NC_002689 HIT (histidine triad) family protein from Thermoplasma volcanium (158 aa); P16436|IPK1_BOVIN protein kinase C inhibitor 1 (pkci-1) from Bos taurus (Bovine) (125 aa),FASTA scores: opt: 195, E(): 5.2e-08, (33.3% identity in 111 aa overlap); etc. Also shows similarity with Rv2613c|MTCY01A10.20A CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (195 aa) and Rv1262c|MTCY50.20 HYPOTHETICAL HIT-LIKE PROTEIN (144 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 856015 | 856347 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0782c|Mb0782c
MAFLTIEPMTQGHTLVVPRAEIDHWQNVDPALFGRVMSVSQLIGKAVCRAFSTQRAGMIIAGLEVPHLHIHVFPTRSLSDFGFANVDRNPSPGSLDEAQAKIRAALAQLA
Bibliography
No article yet recorded