Gene Mb0811
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | conserved protein |
Comments | Mb0811, -, len: 79 aa. Equivalent to Rv0787A, len: 79 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 78 aa overlap). Conserved hypothetical protein, equivalent to MLCB5.24 HYPOTHETICAL PROTEIN from Mycobacterium leprae (79 aa), FASTA scores: opt: 434,(84.8% identity in 79 aa overlap). Also similar to P12049|YEXA_BACSU HYPOTHETICAL 9.7 KD PROTEIN from Bacillus subtilis (84 aa), FASTA scores: opt: 172, E(): 4e-06, (44.4% identity in 72 aa overlap). BELONGS TO THE UPF0062 FAMILY. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 884714 | 884953 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0811|Mb0811 MARVVVHVMPKAEILDPQGQAIVGALGRLGHLGISDVRQGKRFELEVDDTVDDTTLAEIAESLLANTVIEDWTISRDPQ
Bibliography
No article yet recorded