Gene Mb0828
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | class iii cyclic nucleotide phosphodiesterase (cnmp pde) |
| Comments | Mb0828, -, len: 318 aa. Equivalent to Rv0805, len: 318 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 318 aa overlap). Conserved hypothetical protein, equivalent to Q50024 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium leprae (317 aa),FASTA scores: opt: 1713, E(): 0, (82.5% identity in 315 aa overlap). Also shows similarity with hypothetical proteins and icc proteins e.g. SC9B1.22c|T35867 hypothetical protein from Streptomyces coelicolor (305 aa); P36650|ICC_ECOLI icc protein from Escherichia coli (275 aa), FASTA scores: opt: 310, E(): 8.9e-14, (31.3% identity in 214 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 899661 | 900617 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0828|Mb0828
MHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHPPMVLTSSAPRSPVD
Bibliography
No article yet recorded
