Gene Mb0850c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | metal sensor transcriptional regulator kmtr (arsr-smtb family) |
| Comments | Mb0850c, -, len: 130 aa. Equivalent to Rv0827c,len: 130 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 130 aa overlap). Probable transcriptional regulator, similar to many e.g. CAC42856.1|AL592292 putative regulatory protein from Streptomyces coelicolor (115 aa); NP_301626.1|NC_002677 putative ArsR-family transcriptional regulator from Mycobacterium leprae (140 aa); BSUB0011_75|O31844|Z99114 YOZA PROTEIN from Bacillus subtilis (107 aa), FASTA scores: opt: 208, E(): 3.2e-08, (35.5% identity in 93 aa overlap); etc. Also similar to MTCY27.22c|Z95208 from Mycobacterium tuberculosis (135 aa), FASTA scores: opt: 201, E(): 1.2e-07, (35.7% identity in 98 aa overlap). Contains probable helix-turn helix motif from aa 42-63 (Score 1300, +3.61 SD). |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 921571 | 921963 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0850c|kmtr
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG
Bibliography
No article yet recorded