Gene Rv0827c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Represses transcription from the KMTR operator-promoter. Repression is alleviated by NI(II) or cobalt(II). |
| Product | Metal sensor transcriptional regulator KmtR (ArsR-SmtB family) |
| Comments | Rv0827c, (MTV043.19c), len: 130 aa. KmtR, transcriptional regulator (See Campbell et al., 2007), similar to many e.g. CAC42856.1|AL592292 putative regulatory protein from Streptomyces coelicolor (115 aa); NP_301626.1|NC_002677 putative ArsR-family transcriptional regulator from Mycobacterium leprae (140 aa); BSUB0011_75|O31844|Z99114 YOZA protein from Bacillus subtilis (107 aa), FASTA scores: opt: 208, E(): 3.2e-08, (35.5% identity in 93 aa overlap); etc. Also similar to MTCY27.22c|Z95208 from Mycobacterium tuberculosis (135 aa), FASTA scores: opt: 201, E(): 1.2e-07, (35.7% identity in 98 aa overlap). Contains probable helix-turn helix motif from aa 42-63 (Score 1300, +3.61 SD). Belongs to the ArsR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures (see Stewart et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Microarrays show increased expression of Rv0826 and Rv2025c in M. tuberculosis H37Rv Rv0827c mutant (See Campbell et al., 2007). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 920741 | 921133 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0827c|kmtR
MYADSGPDPLPDDQVCLVVEVFRMLADATRVQVLWSLADREMSVNELAEQVGKPAPSVSQHLAKLRMARLVRTRRDGTTIFYRLENEHVRQLVIDAVFNAEHAGPGIPRHHRAAGGLQSVAKASATKDVG
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Campbell DR et al. [2007]. Mycobacterial cells have dual nickel-cobalt sensors: sequence relationships and metal sites of metal-responsive repressors are not congruent. Function Mutant Product
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant