Gene Mb0890
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable molybdenum cofactor biosynthesis protein e2 moae2 (molybdopterin converting factor large subunit) (molybdopterin [mpt] converting factor, subunit 2) |
| Comments | Mb0890, moaE2, len: 141 aa. Equivalent to Rv0866,len: 141 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 141 aa overlap). Probable moaE2,molybdopterin converting factor E (molybdopterin converting factor (subunit 2)), similar to others e.g. Y10817|ANY10817_4|T44853 molybdopterin biosynthesis protein E chain from Arthrobacter nicotinovorans plasmid pAO1 (155 aa), FASTA scores: opt: 460, E(): 3.5e-27, (49.3 identity in 146 aa overlap); CAC01331.1|AL390968 moaE-like protein from Streptomyces coelicolor (152 aa); NP_389313.1|NC_000964 molybdopterin converting factor (subunit 2) from Bacillus subtilis (157 aa); etc. Also highly similar to Rv3119|MOAE1|Z95150|MTCY164_30 PUTATIVE MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN E from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 321, E(): 5.9e-17, (40.9% identity in 132 aa overlap); and O53375|GPHA|Rv3323c|MTV016.23c MOAD-MOAE FUSION PROTEIN from Mycobacterium tuberculosis (221 aa). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 964569 | 964994 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0890|moaE2
MTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRLEYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVAADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV
Bibliography
No article yet recorded
