Gene Mb0892c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable molybdenum cofactor biosynthesis protein d 2 moad2 (molybdopterin converting factor small subunit) (molybdopterin [mpt] converting factor, subunit 1) |
| Comments | Mb0892c, moaD2, len: 92 aa. Equivalent to Rv0868c,len: 92 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 92 aa overlap). Probable moaD2,molybdenum cofactor biosynthesis protein (molybdopterin converting factor (subunit 1)), similar to CAB88494.1|AL353816 putative molybdopterin converting factor from Streptomyces coelicolor (84 aa); and weakly similar to others MoaD proteins e.g. Z99111|BSUB0008_103 from Bacillus subtilis (77 aa), FASTA scores: opt: 86,E(): 2.8, (22.9% identity in 83 aa overlap); etc. Also some similarity with Rv3112|MOAD1|MTCY164.22 PUTATIVE MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN D from Mycobacterium tuberculosis (83 aa), FASTA scores: opt: 113, E(): 0.024, (31.3% identity in 83 aa overlap). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 966443 | 966721 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0892c|moaD2
MTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG
Bibliography
No article yet recorded
